Semaglutide、Cagrilintide、Liraglutide、Tirzepatide、Retatrutide
QiMao Biotechnology Co., Ltd
Country: China (Mainland)
Business Type: Trading Company
Mr.Dong
Tel: --
Mr.Anne 经理
Tel: 15100003236
Please mention that you found the contact information on LookChem.
YGRKKRRQRRRPPQGQVVSNGKSAAEQSCAS NO.:
EdotreotideCAS NO.: 204318-14-9
C-Peptide(57-87),HumanCAS NO.: 33017-11-7
Deltasleep-inducing peptideCAS NO.: 62568-57-4
cyclic citrullinated peptide; CCPCAS NO.: 39577-43-0
Calcitonin salmonCAS NO.: 47931-85-1
Amyloid β-Protein(16-22)CAS NO.: 153247-41-7
SemaglutideCAS NO.: 910463-68-2
AntideCAS NO.: 112568-12-4
Mastoparan BCAS NO.: 137354-65-5
IndolicidinCAS NO.: 140896-21-5
Cathepsin G(1-5)CAS NO.:
The K4 peptideCAS NO.: 1163064-86-5
Cyclic dodecapeptideCAS NO.:
ProtonectinCAS NO.:
Combi-2CAS NO.:
lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog
hot product 204318-14-9 33017-11-7 62568-57-4 39577-43-0 47931-85-1 910463-68-2 112568-12-4 137354-65-5 140896-21-5
What can i do for you?
Contact Supplier
Mr.Dong Tel:--
Mr.Anne 经理 Tel:15100003236