Semaglutide、Cagrilintide、Liraglutide、Tirzepatide、Retatrutide
QiMao Biotechnology Co., Ltd
Country: China (Mainland)
Business Type: Trading Company
Please mention that you found the contact information on LookChem.
GLP1(7-37).TFACAS NO.: 204521-68-6
Decapeptide-12CAS NO.: 137665-91-9
Hexapeptide-11CAS NO.: 100684-36-4
Acetyl tetrapeptide-15CAS NO.: 928007-64-1
Hexapeptide-2CAS NO.:
EptifibatideCAS NO.: 188627-80-7
Nesiritide acetateCAS NO.: 114471-18-0
LypressinCAS NO.: 50-57-7
VapreotideCAS NO.: 103222-11-3
PasireotideCAS NO.: 396091-73-9
NH2-Cys-Phe-cyclo(Orn-Pro-D-Cha-Trp-Arg)CAS NO.:
YGRKKRRQRRRPPQGQVVSNGKSAAEQSCAS NO.:
EdotreotideCAS NO.: 204318-14-9
C-Peptide(57-87),HumanCAS NO.: 33017-11-7
Deltasleep-inducing peptideCAS NO.: 62568-57-4
cyclic citrullinated peptide; CCPCAS NO.: 39577-43-0
lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog
hot product 204521-68-6 137665-91-9 100684-36-4 928007-64-1 188627-80-7 114471-18-0 50-57-7 103222-11-3 396091-73-9 204318-14-9
WhatsApp
Contact Supplier
Ms.Dong Tel:--
Ms.Anne 经理 Tel:852 9173 6421